1. Notes: 3281 / 3 weeks ago  from dcwomenkickingass

    dcwomenkickingass:

    The best damn thing you’ll see all day

    Batman fan Doğan Can Gündoğdu has created an opening credits sequence for The Dark Knight Rises which the real movie will be very lucky to top. With a pounding, industrial sounding soundtrack you’ll see the standard opening credits and then flashes of ice and other items as the credit sequence takes on an unsettling ton. Just go watch it!

    Reminds me of that sweet fan-made opening titles sequence for The Walking Dead and how it was better than the entirety of that show.

    (Source: firstshowing.net)

  2. Notes

    1. ill-burn-the-heart-out-of-you reblogged this from dc-youngsters
    2. some-kind-of-nature reblogged this from vworp
    3. vworp reblogged this from treesquirrrel and added:
      Woa, he’s a genius.
    4. thereisaboggartinthetardis reblogged this from holyhandgrenaded
    5. hamartiaaa reblogged this from allonsyblue
    6. rikkemorningstar reblogged this from thefilmfatale
    7. thinkingofelephants reblogged this from 13dwarvesandahobbit
    8. 13dwarvesandahobbit reblogged this from batcatrules
    9. christiekitty reblogged this from widdlez
    10. batcatrules reblogged this from widdlez
    11. widdlez reblogged this from memorypops
    12. diurnicity reblogged this from memorypops and added:
      So I’m pretty sure that my eyes just jizzed everywhere or maybe those are tears….. Either way, that is some god dang...
    13. lusciousgrapes reblogged this from kyoinacerealbox
    14. thatsawesomme reblogged this from acciosweetdaleks
    15. thewhiteerabbit reblogged this from anima-sorella
    16. zigandeadinside reblogged this from snowtrooper and added:
      The hands were slightly distracting, but omg that was genius…..
    17. ascandalingallifrey reblogged this from staying-alive-is-so-boring
    18. frilled-shark reblogged this from dc-youngsters
    19. amordeive reblogged this from grandmanoiseverything
    20. cassiuskillard reblogged this from grandmanoiseverything
    21. teen-ager reblogged this from staying-alive-is-so-boring
    22. grandmanoiseverything reblogged this from staying-alive-is-so-boring
    23. staying-alive-is-so-boring reblogged this from moriarteaisreal
    24. moriarteaisreal reblogged this from anima-sorella
    25. anima-sorella reblogged this from buuueller
    26. ms-lyla-loves reblogged this from batski
    27. keepyourheartclosed reblogged this from drjohnwatsons
avatar_128
 
 
I had no idea I was so well known.
 
 

Following

nerdycouturefuckyeahjosswhedonfuckyeahdementiazimagesawyeahsuperheroartneil-gaimanoldfilmsflickermelaphantasticsoulbotsstumblingthroughlifebillhicksfuckyeahhotactress-fuckyeahmoviequotes-badlydrawnpokemonlookatthisfrakkinggeekstergirlswithglassesstarwarslovermattsbrickgalleryjameskilifefuckyeahanimeboom-yummydid-you-knotheeverydaygothduss005fuckyeahtoonamifuckyeah1990sjamiebuttpoke-problemsgifmoviefuckyeahjustifiedoestranhomundodekcosplaydeviantsgamegifshorrorfixxxeyesfavecandyoldhollywoodmeme-spotsvaltscomicbookcoversmantiseyesimpledisneythingslisasgotbeatsshotguysreadingbooksfuckyeahmoviepostersgingerhazefuckyeahdirectorsbarackobamacussyeah-wesandersondcwomenkickingassfuckyeahgeekgirlsgameraddictionsadventuretimehorrorharbourkeepsdiarymarcustohellyesannapaquinlotrcapskmckenfuckyeahcaptainamericaminifiguresdigimon-forevercollegeproblemsgailsimonehitrecordjoehitrecordmost-beautiful-songs-of-all-timegreatcosplaytextsfromharlancountyfuckyeahfireflyfuckyeahurbantribesimharoldsmithhumongousentertainmentthedisneyprincessspongegifsretrostarwarsgqfashionfuckyeahfelinesfyeahdickgraysonpixelfucksexpertcosmotipsnpryo-she-bitchnervemediaphilnotomusic-in-gamesteamcocofypblogsteampunkdnerdygirllovex-menofthe90sfirstbookfuckyeahsupermanandrazorwiresaprophagethedrunkenmooglescottlavamoviesinframescomicbooksgeek-artcreepygirllovelifeonmars0twinpeaksgifsdailyvidettedailybunnygqdailyottertragedyseriesnewspaperblackoutbetterbooktitlesfakecriterionsgodsaveourbareskindcufuckyeahwoodyallenmissmamrothspiltmllkkfuckyeahdarioargentohorrorkingmickeygregoryteamteachersmlwallanevermindthebolexcooljeremybrovengersnatazillavidettemoviesblogkimjongillookingatthingscobrajcobracuriousintentgeeksintightsfuckyeahdegrassisecretsdoctormonoclegarfieldminusgarfieldgoddesscubesfuckyeahmeninsuitslamestain15zombifyaskdickanddamiangifakepeddlingbutterfliesfuckyeahcareyjesuskirkandvinnyfuckyeahsharksfuckyeahrule63thisfeliciadayoddfutureidrawnintendofuthshdavidschillerfuckyeahdrorpheushotchicksinstarwarsshirtsoracle-create-a-thonfuckyeahstephencolbertadultingjusticeleagueanimateddocshanerkanyepluscomicsfuckyeahvoltaireeyeonspringfieldmattmelvindennisculverfuckyeahredhairamandapalmercannotunseecopycatsmondaymuseihatemyparentsfuckyeahlordoftheringsfyeahobscurestarwarscharactersltmsscatterbrainfuckyeahleft4deadmaryhatewookieekissesdirectorscutslunchbagartanhorsesexpugsandtacobellmysterysongssmashingpinatasamidalagirlsfuckyeahcowboybebopdegrassiismylifecatrouletteetiquetteforaladywirrowlistentothebitnudereadingissexyohmickeyyouresofinewilwheatonkyleanthonyyfeministryangoslingtheoccultcomicscornerjaborwhalkybewarethehorrorblogfuckyeahdochammertomhanksimalsmarynatemichaelfassbenderwithpugssummerglauvidettedatingblogverymarykatenowthisisgothicfuckyeahjonstewartohyeahemmawatsontextsfromteamventureholymaurymotherofgodlouieandersonisaliveandwellfuckyeahnphartsygamerlovegifsitsalwayssunnybythegodswheresrandysavagefuckyeahcarriefishereverythingharrypotterboohoobooreverendcreepfuckyeahcomicrelationshipsfuckyeahteamventuredavidbowiesuiteduprobhuebelcomicbookviolencefragyeahyoungjusticewallpaperartfuckyeahjlipolliticallyincorrect52booksjamesurbaniak2nfullcosplaypinkoftheinkmorebetterfuckyeahbirdsofpreycomicsepicfuckyeahsupergirlnursepitonthefilmdirectoryfyeahpowergirlfuckyeahdisneyvillainsthings-i-want-2-put-my-penis-iniwdrmthe-drivereldritch-thoughtsohnocthulhudictionaryofobscuresorrowswenchesunbornchildwritersroutineslaurenwhitacrethingslearnedfrombtvssupervillainshowdownlesbianswholooklikejustinbiebercliffchiangcodyshermanvictorstuberbrucewaynefactsgooglyeyedpokemonpinupcandyfygogolbordellohellopoetryonemanwolfpackohyeahstarwarssurvivalsallyfuckyeahollievalentinsaljaaliciaferrarissexykinshipsterstartrekasklordcthulhueffyeahspongebobeverythingstartrekbleepbloopblogsollyfourthshowhermyohfacesammiirenehowirememberitasghostsdoretconpunchformerlyzatannafyeahchronotriggermoviesanddrinkingvideogamesarelifefuckyeaheyegasmswaltfuckingdisneygothtipsawyeahtitansragetoonsdealbreakerfuckyeahdamianwaynemarkkotiwhasstoriesienjoysquirrelstheyounggentlemanfuckyeahbunnymendallaslostasktitansfuckyeahmarvelfilmsfyeahsilveragesecrets
 

Tumblr